Transcript | Ll_transcript_253438 |
---|---|
CDS coordinates | 493-825 (+) |
Peptide sequence | MVLHSKLMSLGRGVCEQVPEFPSKLFFYCEVEPGSGGETPIVLSHVVYERMKEKYPEFVERLEKYGLLYIRVLGEDDNPSSPIGRGWKSTFLTTDKSVAEQRFVLFNQPS* |
ORF Type | complete |
Blastp | Clavaminate synthase-like protein At3g21360 from Arabidopsis with 82.95% of identity |
---|---|
Blastx | Clavaminate synthase-like protein At3g21360 from Arabidopsis with 82.95% of identity |
Eggnog | taurine catabolism dioxygenase taud tfda(ENOG410XPT7) |
Kegg | Link to kegg annotations (AT3G21360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436463.1) |
Pfam | Taurine catabolism dioxygenase TauD, TfdA family (PF02668.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer