Protein coding transcript 152629

• Transcript: Ll_transcript_252590
• CDS coordinates: 3318-3623 (+)
• Peptide sequence: MKGSTKEEYFKESRIEVPPTSMAAHVIDEEIEIELNDRTDISETLQTKNENGVAHEAKSLLLMLHPPLIPRSNYSRYEGDDENVDVDGLDEEDAGAHVDIV*
• ORF Type: complete

Annotations of Ll_transcript_252590

• Blastp: Zinc finger CCCH domain-containing protein 13 from Oryza sativa with 43.06% of identity
• Blastx: Zinc finger CCCH domain-containing protein 40 from Arabidopsis with 35.51% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG4112ATJ)
• Kegg: Link to kegg annotations (4328385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453762.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;