Protein coding transcript 152630

• Transcript: Ll_transcript_252591
• CDS coordinates: 224-646 (+)
• Peptide sequence: MVERRQFKTRLCVLYQRGRCNRNNCSFAHGNVELRRFSASNSGRREYPGNDLRDKLDRRYLSPPRRYSPPRDGRGPQAIHGYSPSRSSEKKSDRRHIRKQGTSSQRDNLESLKFSDRIPDQVKEGKLFSSGSRNTLDEQV*
• ORF Type: complete

Annotations of Ll_transcript_252591

• Blastp: Zinc finger CCCH domain-containing protein 13 from Oryza sativa with 42.14% of identity
• Blastx: Zinc finger CCCH domain-containing protein 40 from Arabidopsis with 33.33% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG4112ATJ)
• Kegg: Link to kegg annotations (4328385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453763.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;