Protein coding transcript 152673

• Transcript: Ll_transcript_252150
• CDS coordinates: 702-1163 (+)
• Peptide sequence: MSNMLLWLSLFHLSQNSYHFGMELLRSDTLVGDSMLKHLWHHHDAILCCSLKSLPVFVFANQAGLDMMETTLVALQDITLDKIFDESGRKAFFADFAKLMQQGFAYVPSGMCMSTMGRHVSYEQAIAWKVFGEGDNNNNVHCLAFSFINWSFL*
• ORF Type: complete

Annotations of Ll_transcript_252150

• Blastp: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 74.31% of identity
• Blastx: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 75.54% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG410ZJBV)
• Kegg: Link to kegg annotations (AT5G60690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458095.1)
• Pfam: MEKHLA domain (PF08670.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;