Protein coding transcript 152675

• Transcript: Ll_transcript_252158
• CDS coordinates: 1-345 (+)
• Peptide sequence: KPGGKNDVTTANETLDLTSGLEVSPSTNNADGDASSGYSNRSVLTIAFQFPFDSSLQDNIALMAIQYVRSVICSVQRIAMAISPPGINPAISAKSSPGSPEALTLAHWICQSYR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_252158

• Blastp: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 64.91% of identity
• Blastx: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 81% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG410ZJBV)
• Kegg: Link to kegg annotations (AT5G60690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458095.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;