| Transcript | Ll_transcript_251996 |
|---|---|
| CDS coordinates | 46-447 (+) |
| Peptide sequence | MSDVKALAMDMVKDPISVSPSKMDPHGGRKNPSPENDTAALELKKRNEELEKELKESKAREEEMTRMLHSAWERLRVAEDAEERLCSELGDLEAEAVHQAREYHAQIVFLTEQLSRAQTLVHKSSSSISIPSS* |
| ORF Type | complete |
| Blastp | Protein RESPONSE TO LOW SULFUR 4 from Arabidopsis with 50.67% of identity |
|---|---|
| Blastx | Protein RESPONSE TO LOW SULFUR 4 from Arabidopsis with 56.6% of identity |
| Eggnog | NA(ENOG410ZF0Z) |
| Kegg | Link to kegg annotations (AT5G24655) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415903.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer