Transcript | Ll_transcript_253072 |
---|---|
CDS coordinates | 3872-5119 (+) |
Peptide sequence | MGDRNEAEKVDEVMLPGFRFHPTDEELVGFYLKRKIQQWPMSIELIKQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSEGSKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRLPSLTDSSPSPKKYIDKTIPTNDSWAICRIFKKTNATAQRALSNSWVSPLPETRTSDMLTNDGNSTHFCSSNMLLTNQTGLARQFCNINHNDTHHLTTSISTLCPLDVASYNKSIINPLLYKPFDQLPNSNGHISTGLMFSTPLETSTTSAKSTVDVSSLLLNMSSSVLGDFSKPCEGTTTNFGVLQEHNHGYSIPLQREMQETIGNQYDSVLVKIPNINVPCVDEQELEKVRSIGFPLSVPNFNIGDAWKSNLLWDSSSCDYVSSSYSTTKCYT* |
ORF Type | complete |
Blastp | Protein FEZ from Arabidopsis with 55.34% of identity |
---|---|
Blastx | Protein FEZ from Arabidopsis with 66.17% of identity |
Eggnog | NAC domain-containing protein(ENOG410YHVU) |
Kegg | Link to kegg annotations (AT1G26870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445942.1) |
Pfam | No apical meristem (NAM) protein (PF02365.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer