Protein coding transcript 152935

• Transcript: Ll_transcript_253593
• CDS coordinates: 517-852 (+)
• Peptide sequence: MNLPPLRISNSAPVTPPLSSPTARTSSKRKANFESLVIPNASALNPFIHPLYTASAPSSPSRRHRHRAGTFTIPEHDESDASTIDSGRWVSFQNSPAPPSPTFSLMNPAIMH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_253593

• Blastp: BES1/BZR1 homolog protein 2 from Arabidopsis with 60.36% of identity
• Blastx: BES1/BZR1 homolog protein 2 from Arabidopsis with 57.78% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G36780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444747.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;