Protein coding transcript 1531

• Transcript: Ll_transcript_534095
• CDS coordinates: 2-367 (+)
• Peptide sequence: GGFGGSGGDRMGELGAGLKQQNYDVNTLPKFEKAFYKEDPAVTARSQADVDKFRADNAMTLAGTDIPRPVETFDEAGFPGYVMNEVKAAGFAKPTAIQSQGWPMALSGRDVVGVAETGSGKT
• ORF Type: internal

Annotations of Ll_transcript_534095

• Blastp: ATP-dependent RNA helicase dbp2 from Aspergillus with 76.32% of identity
• Blastx: ATP-dependent RNA helicase DBP2 from Chaetomium with 77.98% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AN5931.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014516680.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;