Protein coding transcript 153104

• Transcript: Ll_transcript_251975
• CDS coordinates: 2204-2827 (+)
• Peptide sequence: MMITEKDDHQAASESWYLDTGCSNHMTCHKDWFTSLDTSVKTKVRFADNSSINAEGIGEILISRRDGASSSISSVLYVPKMRSNLISLMQLLEKGYRIRMEDKQLRIFNKRGISILKAPLSSNRTFKIGIQLKDQKCLQAAANDSSLWHQRFCHLNQQSLELLSSTKMVLGMPEIKSTTHMCEKCVTSKETRNTFASQVHTKLVDNYN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_251975

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 25.96% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 43.52% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414559.1)
• Pfam: GAG-pre-integrase domain (PF13976.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;