Protein coding transcript 153140

• Transcript: Ll_transcript_251519
• CDS coordinates: 3-491 (+)
• Peptide sequence: CDISLIEGFGFGVDLIHRDSPKSPFYIPSETRYERVAKAIRRSINYVDRFNKPSFSTNNVESKVVPNGGEYLMSYSIGTPPVEILGIVDTGSDILWLQCEPCNPCYKQTTPIFNPANSTTYKNIPCTSTTCKSVRSSICSSKGDQQSCQYRIGYGDGSRSQGD
• ORF Type: internal

Annotations of Ll_transcript_251519

• Blastp: Aspartic proteinase CDR1 from Arabidopsis with 47.74% of identity
• Blastx: Aspartic proteinase CDR1 from Arabidopsis with 47.74% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT5G33340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424967.1)
• Pfam: Eukaryotic aspartyl protease (PF00026.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;