Protein coding transcript 153157

• Transcript: Ll_transcript_252436
• CDS coordinates: 181-738 (+)
• Peptide sequence: MVHPKKFRGVRQRHWGSWVAEIRHPLLKRRVWLGTFETAEEAARAYDEAAILMSGRNAKTNFPISDKPNETHQKSSTTTTSSSSSSSSSSKSLSEILSAKLRKCCKSPSPSLTCLRLDNENSHIGVWQKRAGSRSDSNWIMMVELERKNVTLEGPNSDDSELQVQEPQIQEKVIKPEEINNNNNNN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_252436

• Blastp: Ethylene-responsive transcription factor WIN1 from Arabidopsis with 78.08% of identity
• Blastx: Ethylene-responsive transcription factor WIN1 from Arabidopsis with 70.41% of identity
• Eggnog: Transcription factor(ENOG4111RRZ)
• Kegg: Link to kegg annotations (AT1G15360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442025.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;