Protein coding transcript 153159

• Transcript: Ll_transcript_252438
• CDS coordinates: 114-815 (+)
• Peptide sequence: MAPREKLSDLSGSNPTQLATKEIRYRGVRKRPWGRYAAEIRDPSKKTRVWLGTFDTAEEAARAYDQAAILMSGRNAKTNFPITQTPEGDPKIMTSNNDNTTSSNSKDLEETLHAKLRKCGKVPSPSMTCLRLDTENSHIGVWQKRAGQRSDSNWVMTVQLGKKKSGQNNECGEDCSSSSSLPSSTSSDKNNNNNQSLSALVAENDQEQVQVRTQMDEEDRIALQMIEELLNRS*
• ORF Type: complete

Annotations of Ll_transcript_252438

• Blastp: Ethylene-responsive transcription factor WIN1 from Arabidopsis with 50.7% of identity
• Blastx: Ethylene-responsive transcription factor WIN1 from Arabidopsis with 49.06% of identity
• Eggnog: Transcription factor(ENOG4111RRZ)
• Kegg: Link to kegg annotations (AT1G15360)
• CantataDB: Link to cantataDB annotations (CNT0000893)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440110.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;