Protein coding transcript 153162

• Transcript: Ll_transcript_252454
• CDS coordinates: 2-307 (+)
• Peptide sequence: DTENSHIVVSQKRAGQRSDSNWVMTVQLGKKKSGQNNECGEDCSSSSFLPSSTSSDKNNNNNQSLSALVAENDQEQVQVRTQMDEEDRIALQMIEELLNRS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_252454

• Blastp: Ethylene-responsive transcription factor WIN1 from Arabidopsis with 42.42% of identity
• Blastx: Ethylene-responsive transcription factor WIN1 from Arabidopsis with 36.73% of identity
• Eggnog: Transcription factor(ENOG4111RRZ)
• Kegg: Link to kegg annotations (AT1G15360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440110.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;