Transcript | Ll_transcript_252433 |
---|---|
CDS coordinates | 43-963 (+) |
Peptide sequence | MVSTNEVPNKPLQGVSLQSTDPTFLSSSKRLEGKVAIVTGGARGIGEAIVRDFVKHGAKVVIADIDDEEGTKLQSSLSPSATYVHCNVSSEEEVENLVRFTVSHYGQLDIMFNNAGVLGNQSKNKSIVNFDPNEFEKVMSVNVKGMALGIKHAARVMIPRGVGCIISTSSVAGVMGGLGPHAYTASKHAIVGITKNTACELGRYGIRVNCISPFGVATSMLVNGWKNKSGEEDDDDINNFGVPSQEEVEKMEEFVRGLGNLKGATLRPKDIAEAAVYLASDESKYVSGHNLVVDGGITSSINCIGL* |
ORF Type | complete |
Blastp | Short-chain dehydrogenase reductase 2a from Arabidopsis with 64.53% of identity |
---|---|
Blastx | Short-chain dehydrogenase reductase 2a from Arabidopsis with 64.53% of identity |
Eggnog | Dehydrogenase reductase(COG1028) |
Kegg | Link to kegg annotations (AT3G51680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450532.1) |
Pfam | short chain dehydrogenase (PF00106.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer