Protein coding transcript 153165

• Transcript: Ll_transcript_252442
• CDS coordinates: 1630-1992 (+)
• Peptide sequence: MEGQFIFIDLNNIFLNRYGIRVNCISPFGVATSMLVNGWKNKSGEEDDDDINNFGVPSQEEVEKMEEFVRGLGNLKGATLRPKDIAEAAVYLASDESKYVSGHNLVVDGGITSSINCIGL*
• ORF Type: complete

Annotations of Ll_transcript_252442

• Blastp: Sex determination protein tasselseed-2 from Zea with 59.82% of identity
• Blastx: Short-chain dehydrogenase reductase 2a from Arabidopsis with 65.75% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (542246)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450532.1)
• Pfam: Enoyl-(Acyl carrier protein) reductase (PF13561.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;