Protein coding transcript 153167

• Transcript: Ll_transcript_252451
• CDS coordinates: 1039-1629 (+)
• Peptide sequence: MFNNAGVLGNQSKNKSIVNFDPNEFEKVMSVNVKGMALGIKHAARVMIPRGVGCIISTSSVAGVMGGLGPHAYTASKHAIVGITKNTACELGRYGIRVNCISPFGVATSMLVNGWKNKSGEEDDDDINNFGVPSQEEVEKMEEFVRGLGNLKGATLRPKDIAEAAVYLASDESKYVSGHNLVVDGGITSSINCIGL*
• ORF Type: complete

Annotations of Ll_transcript_252451

• Blastp: Short-chain dehydrogenase reductase 2a from Arabidopsis with 70.56% of identity
• Blastx: Short-chain dehydrogenase reductase 2a from Arabidopsis with 66.43% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT3G51680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450532.1)
• Pfam: Enoyl-(Acyl carrier protein) reductase (PF13561.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;