Protein coding transcript 153168

• Transcript: Ll_transcript_252456
• CDS coordinates: 43-663 (+)
• Peptide sequence: MVSTNEVPNKPLQGVSLQSTDPTFLSSSKRLEGKVAIVTGGARGIGEAIVRDFVKHGAKVVIADIDDEEGTKLQSSLSPSATYVHCNVSSEEEVENLVRFTVSHYGQLDIMFNNAGVLGNQSKNKSIVNFDPNEFEKVMSVNVKGMALGIKHAARVMIPRGVGCIISTSSVAGVMGGLGPHAYTASKHAIVGITKNTACELGRYCL*
• ORF Type: complete

Annotations of Ll_transcript_252456

• Blastp: Short-chain dehydrogenase reductase 2a from Arabidopsis with 62.89% of identity
• Blastx: Short-chain dehydrogenase reductase 2a from Arabidopsis with 62.89% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT3G51680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450532.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;