Protein coding transcript 153174

• Transcript: Ll_transcript_252441
• CDS coordinates: 42-629 (+)
• Peptide sequence: MTFLSFYISVKVIICLEYLAPGIDEIVCLVNRKTRIWLGTFETAEDAARAYDEAAKLMCGPKARTNFPCNPNEPHSSSSKLLSATLTAKLHKCHMASLSLQKTKQKPQEKEPHRAQNRSNTFASENVIDTSFRWPDMMMRHEELQWLQGNWVGGESQVEVKEQEFQPVLEDDHIDQMIQELLDYGSIELCFNGSA*
• ORF Type: complete

Annotations of Ll_transcript_252441

• Blastp: Ethylene-responsive transcription factor ERF003 from Arabidopsis with 56.33% of identity
• Blastx: Ethylene-responsive transcription factor ERF003 from Arabidopsis with 56.33% of identity
• Eggnog: Transcription factor(ENOG4111RRZ)
• Kegg: Link to kegg annotations (AT5G25190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457427.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;