Protein coding transcript 153330

• Transcript: Ll_transcript_251477
• CDS coordinates: 126-1088 (+)
• Peptide sequence: MSSVASRGIHFLQRLNAANVPTDLLAKGQDRVIEASLTLIRERAKLKGELVRALGGAVACPSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSTTEEGKQLQDPRVLTDVGDVPIQEIRDCGVDDDRLMNVISESVKLVMEEDPLRPLVLGGDHSISFPVVRAVSEKLGGPVDILHLDAHPDNYDAFEGNKYSHASSFARIMEGGYARRLLQVGIRSITTEGREQAKRFGAEQYEMRTFSKDRSFLENLKLGQGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLEGDVVAADVVEFNPQRDTVDGMT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_251477

• Blastp: Arginase 1, mitochondrial from Oryza sativa with 86.83% of identity
• Blastx: Arginase 1, mitochondrial from Oryza sativa with 86.83% of identity
• Eggnog: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines(COG0010)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447164.1)
• Pfam: Arginase family (PF00491.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;