Protein coding transcript 153437

• Transcript: Ll_transcript_207280
• CDS coordinates: 533-919 (+)
• Peptide sequence: MLAAILNSVSLGSSLDIFTEPSLSREMKVEEERIDAEKRRVLEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDLVDIIKAQLQREVDKRIVELPEIRETGEYIAELKLHPEVTARVKVNVFAN*
• ORF Type: complete

Annotations of Ll_transcript_207280

• Blastp: 50S ribosomal protein L9, chloroplastic from Pisum with 87.96% of identity
• Blastx: 50S ribosomal protein L9, chloroplastic from Triticum with 72.22% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453923.1)
• Pfam: Ribosomal protein L9, C-terminal domain (PF03948.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;