Protein coding transcript 153439

• Transcript: Ll_transcript_207274
• CDS coordinates: 86-664 (+)
• Peptide sequence: MALALPSLSSTSSSLLHHTFTANSNGPSKSKGFLVFAQKKTKKIRKIILKEDVDLLGKKGELIDVRAGFYRNFLHPTGKAQIVTPQLLKEMRVEEERIDAEKRRVKEEAQQLAQIFETVGAFKVKRKGGKGKQIFGSVTAQDLVDIIKAQLQREVDKRIVELPEIRETGEYIAELKLHPEVTARVKVNVFAN*
• ORF Type: complete

Annotations of Ll_transcript_207274

• Blastp: 50S ribosomal protein L9, chloroplastic from Arabidopsis with 70.53% of identity
• Blastx: 50S ribosomal protein L9, chloroplastic from Pisum with 82.25% of identity
• Eggnog: ribosomal protein l9(ENOG4111HFB)
• Kegg: Link to kegg annotations (AT3G44890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449779.1)
• Pfam: Ribosomal protein L9, N-terminal domain (PF01281.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;