Protein coding transcript 153440

• Transcript: Ll_transcript_207275
• CDS coordinates: 97-675 (+)
• Peptide sequence: MASTLPSLSSTSSSLLTHTFTANSNGPNKSAGFLVFAQKKTKKIRKIILKEDVDFLGKKGSLVDVRAGFYRNFLHPTGKASIVTPQLLKEMKVEEERIDAEKRRVLEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDLVDIIKAQLQREVDKRIVELPEIRETGEYIAELKLHPEVTARVKVNVFAN*
• ORF Type: complete

Annotations of Ll_transcript_207275

• Blastp: 50S ribosomal protein L9, chloroplastic from Pisum with 80.66% of identity
• Blastx: 50S ribosomal protein L9, chloroplastic from Pisum with 83.43% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453923.1)
• Pfam: Ribosomal protein L9, N-terminal domain (PF01281.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;