Transcript | Ll_transcript_207202 |
---|---|
CDS coordinates | 300-812 (+) |
Peptide sequence | MTSSVFEDLPEEGKHEPSDLITETMNLTATNLSLPNDTFLRAAISLKDQVVEVTWNRREVIDPTVYSGVLGTAFTCLRSYQVTSNHKDLLLCAQIVHTCSTLARASLRHVTFLCGRGGIYALGAVVANYMGDRVKRDMFLEQFIEVTLTTLKHHNFMAKCFKYSLSLIIK* |
ORF Type | complete |
Blastp | LanC-like protein GCL1 from Arabidopsis with 58.91% of identity |
---|---|
Blastx | LanC-like protein GCL1 from Arabidopsis with 58.91% of identity |
Eggnog | glutathione binding(ENOG410XQIA) |
Kegg | Link to kegg annotations (AT5G65280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416528.1) |
Pfam | Lanthionine synthetase C-like protein (PF05147.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer