Protein coding transcript 153490

• Transcript: Ll_transcript_207202
• CDS coordinates: 300-812 (+)
• Peptide sequence: MTSSVFEDLPEEGKHEPSDLITETMNLTATNLSLPNDTFLRAAISLKDQVVEVTWNRREVIDPTVYSGVLGTAFTCLRSYQVTSNHKDLLLCAQIVHTCSTLARASLRHVTFLCGRGGIYALGAVVANYMGDRVKRDMFLEQFIEVTLTTLKHHNFMAKCFKYSLSLIIK*
• ORF Type: complete

Annotations of Ll_transcript_207202

• Blastp: LanC-like protein GCL1 from Arabidopsis with 58.91% of identity
• Blastx: LanC-like protein GCL1 from Arabidopsis with 58.91% of identity
• Eggnog: glutathione binding(ENOG410XQIA)
• Kegg: Link to kegg annotations (AT5G65280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416528.1)
• Pfam: Lanthionine synthetase C-like protein (PF05147.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;