Protein coding transcript 1535

• Transcript: Ll_transcript_534068
• CDS coordinates: 150-1448 (+)
• Peptide sequence: MRILRNYYSFKCFSTFTNNSSSHYRKQISLANLFQRFGFPTSHFHQFFSLNHRFLLNANLLDLEKSLSTLLSFKIPQNFIVSLIRDCPSVLEHQFLKNWELGFQKIRVFNPSPLMMVNFMQCSKRFELDPLEISKKVEIFKGFGFSDSAMAMVFEGFPTAIAMSQKEVVSVIEFLVEFGIPRDEIDGVVRYYPRVLGFGVEDRLKPLIHELRGLGFLGREVRKEIVRDPRILGMEVGEFSRCLQLLNSLKCREAIKERIIGEGGMLRACFEVKLRVDCLCGHGLIRRDALKVLWKEPRLITYDLENIEKKIEFLVQRMKYSVDCLPHVPEYLGVNLEKQIVPRYTVIEYLIAKGAIEHEVGLKDLIKPTRLRFYNLYVKPYPECEKMYGRFSGALEVKSKHPAGLWKLFKPQKFTETDEDVKNMKSFMELLV*
• ORF Type: complete

Annotations of Ll_transcript_534068

• Blastp: Transcription termination factor MTERF15, mitochondrial from Arabidopsis with 52.38% of identity
• Blastx: Transcription termination factor MTERF15, mitochondrial from Arabidopsis with 52.38% of identity
• Eggnog: mitochondrial transcription termination(ENOG410XT49)
• Kegg: Link to kegg annotations (AT1G74120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414248.1)
• Pfam: mTERF (PF02536.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;