Protein coding transcript 153529

• Transcript: Ll_transcript_207858
• CDS coordinates: 2085-2801 (+)
• Peptide sequence: MPMGARSAMLVRAPPTSIYSHHNVYFFVLVLLLSIPCSCEYVSDGEALLKFKNSLKNVVSLSSWDPTINPKPPCSGNVPNWVGLLCMNDRVWGLRLENMGLTGNIDVESLGSMPALRTLSLMNNTFAGSLPNINMLTNLKALFLSFNHFSGDIPDDAFSTLQKLRKVYLSNNEFTGKIPSSLATLPNLLILALNSNKFQGHIPDFPHKKLRTLNLSNNDFEGSIPTNLTYFDASSFTG*
• ORF Type: complete

Annotations of Ll_transcript_207858

• Blastp: Pollen receptor-like kinase 4 from Arabidopsis with 51.27% of identity
• Blastx: Pollen receptor-like kinase 4 from Arabidopsis with 51.27% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G20190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447616.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;