Transcript | Ll_transcript_207861 |
---|---|
CDS coordinates | 1978-2694 (+) |
Peptide sequence | MPMGARSAMLVRAPPTSIYSHHNVYFFVLVLLLSIPCSCEYVSDGEALLKFKNSLKNVVSLSSWDPTINPKPPCSGNVPNWVGLLCMNDRVWGLRLENMGLTGNIDVESLGSMPALRTLSLMNNTFAGSLPNINMLTNLKALFLSFNHFSGDIPDDAFSTLQKLRKVYLSNNEFTGKIPSSLATLPNLLILALNSNKFQGHIPDFPHKKLRTLNLSNNDFEGSIPTNLTYFDASSFTG* |
ORF Type | complete |
Blastp | Pollen receptor-like kinase 4 from Arabidopsis with 51.27% of identity |
---|---|
Blastx | Pollen receptor-like kinase 4 from Arabidopsis with 51.27% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT3G20190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447616.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer