Transcript | Ll_transcript_206951 |
---|---|
CDS coordinates | 143-787 (+) |
Peptide sequence | MRRASSNLVPSLLSRTIAAASSRSAAASSSFPASNHFLQSALYRTSTTTGGSNNHRRFFSSFLRPYTAASVGVAGALITSLAATSVYQEALAKEPPPAEALPNDVVLYQYEACPFCNKVKAYLDYYDIPYKVVEVNPLSKKEIKWSEYQKVPILVVDGDQLNDSSAIIDKLGQKIMPKKKADENVEETKWRQYGFLFCFIFQSNMSLINIKRLK* |
ORF Type | complete |
Blastp | Prostaglandin E synthase 2 from Danio with 54.17% of identity |
---|---|
Blastx | Prostaglandin E synthase 2 from Bos with 52.75% of identity |
Eggnog | prostaglandin E synthase(ENOG410XS2X) |
Kegg | Link to kegg annotations (799964) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436750.1) |
Pfam | Glutaredoxin (PF00462.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer