Protein coding transcript 153657

• Transcript: Ll_transcript_206958
• CDS coordinates: 2-649 (+)
• Peptide sequence: TAASLGVAGAMFTAVAATPVYQEALAKEPPPPEAIPNDVVLYQYEACPFCNKVKAYLDYHDIPYKVVEVNPLSKKEIKWSEYQKVPILVVDGDQLNDSSAIIDKLGQKILSKKKADEDDEETKWRRWVDNHLVHVLSPNIYRNATEALESFDYITSNGNFSYTEKFSVKYAGAAAMYFVSKKLKKKYNITDERASLYEAAETWVDALNGREFLGM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_206958

• Blastp: Prostaglandin E synthase 2 from Danio with 42.08% of identity
• Blastx: Prostaglandin E synthase 2 from Danio with 43.5% of identity
• Eggnog: prostaglandin E synthase(ENOG410XS2X)
• Kegg: Link to kegg annotations (799964)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433177.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;