Protein coding transcript 153658

• Transcript: Ll_transcript_206959
• CDS coordinates: 1416-2207 (+)
• Peptide sequence: MCFLQSRCTILKLIEGKMEERVQRIQEGNESLEEEDLLNWVLKHSSLSTEQILDLILSLLFAGHETSSVSIALAIYFLPGCPQAMQQLKEEHREIARAKKQAGKVELTWDDYKKMEFTHCVVNETLRLGNVVRFLHRKAIKDVRYKGYDIPCGWKVLPVIAAVHLDPSLFDQPQRFNPWRWQNSGSRGSCPSMSTVSNNFLPFGGGPRLCAGSELAKLEMAVFIHHLILNYHWELTDTDEAFAYPFVDFPKGLPIKVKAHSLL*
• ORF Type: complete

Annotations of Ll_transcript_206959

• Blastp: Cytochrome P450 90B1 from Arabidopsis with 67.27% of identity
• Blastx: Cytochrome P450 90B1 from Arabidopsis with 69.31% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT3G50660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422263.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;