Protein coding transcript 153792

• Transcript: Ll_transcript_208024
• CDS coordinates: 320-1069 (+)
• Peptide sequence: MPDIQPLPEAHVNGAAGGFGSKRRRKPSVRLGDIGGGPPYSDSHHHPRRNNTHKRYKPHPFFNDPNPSFKPSKIRPLTNLTPFQTLDRDGERGHVDSLGIGTWRIKESCKKKGPRKRARSNWVSTDEDKGFDMQNSESSFSEKGSPVENFGVDGLQLQHIRSSSFRGSGGPSDTDDTRDWNKNNSEDGVRVWLSGLGLSRYFSVFRVHEVDYEILPMLTLEDLKDMGISAVGTRRKMFSAVQKLGEGFS*
• ORF Type: complete

Annotations of Ll_transcript_208024

• Blastp: Protein bicaudal C from Sophophora with 37.5% of identity
• Blastx: Protein bicaudal C from Sophophora with 37.5% of identity
• Eggnog: High density lipoprotein binding protein(ENOG410XQFV)
• Kegg: Link to kegg annotations (Dmel_CG4824)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463229.1)
• Pfam: SAM domain (Sterile alpha motif) (PF00536.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;