Protein coding transcript 153796

• Transcript: Ll_transcript_208019
• CDS coordinates: 23-571 (+)
• Peptide sequence: MADQLSHDQITEFREAFSLFDKDGNGCITTKELGTVIRTLRRNLTEAELKDMINEVDANGNVTIDFREFLNLMAGKMRNTDSEEDLKEAFHVFDKDQNGFISAAELHHVITNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMAKMSKRKIEKAGRHNYGTREASSRYKRGRTRTRDRI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_208019

• Blastp: Calmodulin-related protein from Petunia with 75% of identity
• Blastx: Calmodulin-related protein from Petunia with 81.25% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418266.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;