Protein coding transcript 153798

• Transcript: Ll_transcript_208028
• CDS coordinates: 23-472 (+)
• Peptide sequence: MADQLSHDQITEFREAFSLFDKDGNGCITTKELGTVIRTLRRNLTEAELKDMINEVDANGNVTIDFREFLNLMAGKMRNTDSEEDLKEAFHVFDKDQNGFISAAELHHVITNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMAK*
• ORF Type: complete

Annotations of Ll_transcript_208028

• Blastp: Calmodulin-5/6/7/8 from Solanum with 85.91% of identity
• Blastx: Calmodulin-5/6/7/8 from Solanum with 85.91% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (102577873)
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428596.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;