Protein coding transcript 15382

• Transcript: Ll_transcript_425958
• CDS coordinates: 105-419 (+)
• Peptide sequence: MGRIPCCPKEIVKGAWSTEEDEILSQFVTTHGEGKWHKLALKAGLKRCGKSCRQRWLNYLKPGIKRGEISLDEEDMIIRLHRLLGNRSFYFPSLFNPFYLIQFS*
• ORF Type: complete

Annotations of Ll_transcript_425958

• Blastp: Anthocyanin regulatory C1 protein from Zea with 68.18% of identity
• Blastx: Anthocyanin regulatory C1 protein from Zea with 68.18% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (541757)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425531.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;