Transcript | Ll_transcript_207774 |
---|---|
CDS coordinates | 487-1353 (+) |
Peptide sequence | MNFWCFNQQEILEKMKLPSDAELMKIAISDLNNVSLSLEDRYRALHELLELVEPIDNANDLNKLGGLLAVTQELNHSDSGIRTTAAWILGKASQNNPVVQQQVLELRVLSRLMDMVKSNSVEEANKALHAISALIRNNLASHELFYAEAGGLMLQDILRDAKLDIRLRRKAVLLLTDLAEFQLENVDRDEPPFFNDKDLLKSVVDLTASTYLDLQEKALVAIKSLLQLKTTEALVFKDFCALDDALNRMKQLLHDLMEEDESQRDYVIDVESLRIEVFNIFQRKLAKQ* |
ORF Type | complete |
Blastp | Hsp70 nucleotide exchange factor fes1 from Aspergillus with 38.84% of identity |
---|---|
Blastx | Hsp70 nucleotide exchange factor fes1 from Aspergillus with 38.84% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NFIA_051300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457484.1) |
Pfam | Nucleotide exchange factor Fes1 (PF08609.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer