Protein coding transcript 153878

• Transcript: Ll_transcript_207777
• CDS coordinates: 487-1155 (+)
• Peptide sequence: MNFWCFNQQEILEKMKLPSDAELMKIAISDLNNVSLSLEDRYRALHELLELVEPIDNANDLNKLGGLLAVTQELNHSDSGIRTTAAWILGKASQNNPVVQQQVLELRVLSRLMDMVKSNSVEEANKALHAISALIRNNLASHELFYAEAGGLMLQDILRDAKLDIRLRRKAVLLLTDLAEFQLENVDRDEPPFFNDKDLLKSVVDLTASTYLDLQEKVIVGL*
• ORF Type: complete

Annotations of Ll_transcript_207777

• Blastp: Hsp70 nucleotide exchange factor fes1 from Aspergillus with 38.84% of identity
• Blastx: Hsp70 nucleotide exchange factor fes1 from Aspergillus with 38.84% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NFIA_051300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457484.1)
• Pfam: Nucleotide exchange factor Fes1 (PF08609.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;