Transcript | Ll_transcript_209088 |
---|---|
CDS coordinates | 219-1091 (+) |
Peptide sequence | MRGKGDENSRSWVEDIYWTHFKALHFAQLLRTGYDQHLVLPKTFSDNVKKLPENVDLRGPSGVVWNVGLTHKDDAVFFTNGWRQFCKDHSLKENDFLVFKYNGESLFDVLIFDGGNFCEKASSYFVRKCGYTENGGAHLITGEVTDNSVQKVNAPSDTGVQFASPDKSVDDNNLTVFEAVPFKTPAERAFNAGVESASPEQFMEANGVAEPTAVSPQTTGKRTRKQLYAVKPIRSVRRGRAANVSSANLEVVDLVTGNICTYKKRKKISLLYFYGHIFIFKKLNFSKLLS* |
ORF Type | complete |
Blastp | B3 domain-containing protein REM16 from Arabidopsis with 53.38% of identity |
---|---|
Blastx | B3 domain-containing protein REM16 from Arabidopsis with 53.38% of identity |
Eggnog | B3 domain-containing protein(ENOG410YSHE) |
Kegg | Link to kegg annotations (AT4G33280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458604.1) |
Pfam | B3 DNA binding domain (PF02362.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer