Transcript | Ll_transcript_208833 |
---|---|
CDS coordinates | 208-825 (+) |
Peptide sequence | MTDTRGQPQNLSSGEQKQTTLEELPLFEFEQLATATNDFHLSNMLGKGGFGPVYKGKLENGQEIAVKRLAKASTQGLEEFMNEVVVISKLQHRNLVRLLGCCIEGDEQMLVYEFMQNKSLDAFIFDPLQRKDLDWKKRFNIIEGIARGILYLHRDSRLRIIHRDLKASNILLDDQMNPKISDFGLARIFKGSDDYEVNTKRVVGT* |
ORF Type | complete |
Blastp | G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 from Arabidopsis with 75.53% of identity |
---|---|
Blastx | G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 from Arabidopsis with 76.3% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT1G11330) |
CantataDB | Link to cantataDB annotations (CNT0000159) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449111.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer