Protein coding transcript 154002

• Transcript: Ll_transcript_208835
• CDS coordinates: 208-588 (+)
• Peptide sequence: MTDTRGQPQNLSSGEQKQTTLEELPLFEFEQLATATNDFHLSNMLGKGGFGPVYKGKLENGQEIAVKRLAKASTQGLEEFMNEVVVISKLQHRNLVRLLGCCIEGDEQMLVYEFMQNKSLDAFIFG*
• ORF Type: complete

Annotations of Ll_transcript_208835

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 from Arabidopsis with 75% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 from Arabidopsis with 76.34% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G11330)
• CantataDB: Link to cantataDB annotations (CNT0000159)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449111.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;