Protein coding transcript 15403

• Transcript: Ll_transcript_425877
• CDS coordinates: 1346-2113 (+)
• Peptide sequence: MASDQYFEEAMPQMDYIEDKSSPELWESANDTNADSDRNGGFDCNICLESVQDPVVTLCGHLYCWPCIYKWLNFDSFSSEHEEQHNTECPVCKSEISQSSLVPLYGRSQTILPSSRKTRQEGIIIPRRPHGPSLLAGTSRSSNTASFSQPTSPVYHRQYRNHPQQFNSFPGSYTSPMFNTGGSLTNTFNTSYGVFGEMLYSRVFGHQVSNTYPNSYNLSLDGNPRIRRQLIELDKSLNRVCFFLICCIVSCLLLF*
• ORF Type: complete

Annotations of Ll_transcript_425877

• Blastp: E3 ubiquitin-protein ligase RMA1H1 from Capsicum with 45.77% of identity
• Blastx: E3 ubiquitin-protein ligase RMA1H1 from Capsicum with 44.26% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107855034)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429640.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;