Transcript | Ll_transcript_207473 |
---|---|
CDS coordinates | 3-620 (+) |
Peptide sequence | SGHRILFLLTSPTKTPTFPLPPPRRNHPKMQQQQLPRVTAATTGSVVQDAFGGAIALIQSSPATWKSALFSNLFIFLIGSPILVTGLSLNGIAAAFLLGTLIWRAFGPSGFLLVATYFVIGTAATKVKMAQKVAQGVAEKRGGRRGPSSVIGSSVAGCVCAFLTIFGVGGDTFSQLWRLGFVASFCTKLSDTVASEIGKAYGKTT* |
ORF Type | 5prime_partial |
Blastp | Protein VTE6, chloroplastic from Arabidopsis with 78.29% of identity |
---|---|
Blastx | Protein VTE6, chloroplastic from Arabidopsis with 78.29% of identity |
Eggnog | Integral membrane protein DUF92(COG1836) |
Kegg | Link to kegg annotations (AT1G78620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454976.1) |
Pfam | Integral membrane protein DUF92 (PF01940.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer