Protein coding transcript 154063

• Transcript: Ll_transcript_207476
• CDS coordinates: 3-620 (+)
• Peptide sequence: SGHRILFLLTSPTKTPTFPLPPPRRNHPKMQQQQLPRVTAATTGSVVQDAFGGAIALIQSSPATWKSALFSNLFIFLIGSPILVTGLSLNGIAAAFLLGTLIWRAFGPSGFLLVATYFVIGTAATKVKMAQKVAQGVAEKRGGRRGPSSVIGSSVAGCVCAFLTIFGVGGDTFSQLWRLGFVASFCTKLSDTVASEIGKAYGKTT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_207476

• Blastp: Protein VTE6, chloroplastic from Arabidopsis with 78.29% of identity
• Blastx: Protein VTE6, chloroplastic from Arabidopsis with 78.29% of identity
• Eggnog: Integral membrane protein DUF92(COG1836)
• Kegg: Link to kegg annotations (AT1G78620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454976.1)
• Pfam: Integral membrane protein DUF92 (PF01940.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;