| Transcript | Ll_transcript_534073 |
|---|---|
| CDS coordinates | 330-734 (+) |
| Peptide sequence | MHYKTVLFTLLFLDMIEDNEIKMEISFYDKFDWSLCTSVLYSVDSNSRVSVVYLEHISTTDIGVYDVVVLPSFVPSMDSYVHILTKMARGSVNGVLHSSLTKRDTELAEPLVEILEQCGQKVPPTLKDLQNTSK* |
| ORF Type | complete |
| Blastp | DEAD-box ATP-dependent RNA helicase 5 from Oryza sativa with 36.36% of identity |
|---|---|
| Blastx | - |
| Eggnog | purine NTP-dependent helicase activity(COG0513) |
| Kegg | Link to kegg annotations (4342981) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449808.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer