Transcript | Ll_transcript_534073 |
---|---|
CDS coordinates | 330-734 (+) |
Peptide sequence | MHYKTVLFTLLFLDMIEDNEIKMEISFYDKFDWSLCTSVLYSVDSNSRVSVVYLEHISTTDIGVYDVVVLPSFVPSMDSYVHILTKMARGSVNGVLHSSLTKRDTELAEPLVEILEQCGQKVPPTLKDLQNTSK* |
ORF Type | complete |
Blastp | DEAD-box ATP-dependent RNA helicase 5 from Oryza sativa with 36.36% of identity |
---|---|
Blastx | - |
Eggnog | purine NTP-dependent helicase activity(COG0513) |
Kegg | Link to kegg annotations (4342981) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449808.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer