Protein coding transcript 154119

• Transcript: Ll_transcript_207129
• CDS coordinates: 1502-1996 (+)
• Peptide sequence: MCQAYRIQYKWDAISGMPTNLYGPNDNFHPENSHVLPALMRRFHEAKVNKAQEVVVWGTGSPLREFLHVEDLADAVVFMMEKFGGLEHLNVGSGKEVSIKELAELMKEVVGFEGDLVWDTTKPDGTPRKLMDSSKLGGLGWTPKITLKDGLVDTYKWYLENVKQ*
• ORF Type: complete

Annotations of Ll_transcript_207129

• Blastp: Putative GDP-L-fucose synthase 2 from Arabidopsis with 82.32% of identity
• Blastx: Putative GDP-L-fucose synthase 2 from Arabidopsis with 81.25% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT1G17890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461254.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;