Protein coding transcript 1542

• Transcript: Ll_transcript_534089
• CDS coordinates: 1-480 (+)
• Peptide sequence: GGKGGRGKKGGGFATVSSSYKEQLNSLMTTLRSTQPHFVRCIIPNELKQPGVIDSHLVMHQLTCNGVLEGIRICRKGFPNRMNYPDFKLRYMILAPATMQKEKEPKDAAAKCLLEVGLDPDSYRIGHTKVFFRAGVLGQMEELRDDRLGKIISWLQAYIR
• ORF Type: internal

Annotations of Ll_transcript_534089

• Blastp: Myosin heavy chain, muscle from Sophophora with 69.46% of identity
• Blastx: Myosin heavy chain, muscle from Sophophora with 75.68% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (Dmel_CG17927)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003590997.2)
• Pfam: Myosin head (motor domain) (PF00063.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;