Protein coding transcript 154268

• Transcript: Ll_transcript_208752
• CDS coordinates: 288-953 (+)
• Peptide sequence: MGGSISKRRRSRQSSSSRGAHSWYPQYQSPYLPQNQDNVPQGYYGNQPQTQSYGGGHAPEQRKRLDRKYSKIDDDYNSLEQVTEALAGAGLESSNLIVGIDFTKSNEWTGGRSFQRKCLHHIGHEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDGNLRNIIRDYSYALESHVPVSLHCVGFKNMQHQHMTRKFLVSFLMRDFVMDLKKYWDGIGNWSLN*
• ORF Type: complete

Annotations of Ll_transcript_208752

• Blastp: E3 ubiquitin-protein ligase RGLG2 from Arabidopsis with 74.77% of identity
• Blastx: E3 ubiquitin-protein ligase RGLG2 from Arabidopsis with 80.9% of identity
• Eggnog: copine family(ENOG410XPC8)
• Kegg: Link to kegg annotations (AT5G14420)
• CantataDB: Link to cantataDB annotations (CNT0001359)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003526988.1)
• Pfam: Copine (PF07002.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;