Transcript | Ll_transcript_534091 |
---|---|
CDS coordinates | 176-814 (+) |
Peptide sequence | MDFRTSKNVGGSEKGGPCGACKFLRRKCEKGCIFAPYFDSDQGTAHFAAVHKVFGASNASKLLMRIPVPKRLDAVVTLCYEALARARDPVYGCVGHIFSLQQQVVNLQAELTYVQARLATMHRLPIALHPQTSSPTSFPSSSDHLASNAELHCSSNMSMHFDPPQPHSSSLELSNNVNPFCQELEDGELQAVALEFVSRYLPGVRFQPPNSH* |
ORF Type | complete |
Blastp | LOB domain-containing protein 19 from Arabidopsis with 55.44% of identity |
---|---|
Blastx | LOB domain-containing protein 19 from Arabidopsis with 54.92% of identity |
Eggnog | Protein of unknown function DUF260(ENOG4110617) |
Kegg | Link to kegg annotations (AT2G45410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464145.1) |
Pfam | Lateral organ boundaries (LOB) domain (PF03195.13) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer