Protein coding transcript 154327

• Transcript: Ll_transcript_207410
• CDS coordinates: 1-303 (+)
• Peptide sequence: LPALREAPSVKQIDGEWRYDSRNSILEWSVLLIDNSNRSGSMEFVVPQADSSAFFPISVRFVATETFSDLKVTNIIPLKGGNPPKFSQRTQLITENYQVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_207410

• Blastp: Coatomer subunit delta-2 from Oryza sativa with 80% of identity
• Blastx: Coatomer subunit delta-2 from Oryza sativa with 80% of identity
• Eggnog: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins(ENOG410XRH2)
• Kegg: Link to kegg annotations (4338376)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452390.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;