Protein coding transcript 154329

• Transcript: Ll_transcript_207716
• CDS coordinates: 134-805 (+)
• Peptide sequence: MSLISNCSPSYATVAGAGAGAAASNRRPKFPSNSWINTNAISQNDKFNVSRLALSHSNHRVKDRTISMALVGGALGQKGDVSTSSSTLAYDLIQGALVRWSSDMDRSLPAPPTAVFLHGILGCRKNWGTFARRLAQGFPTWQFLLVDMRCHGDSASIKKRGPHTVQSAALDVLKLVRELRITPRVLVGHSFGGKVALSMVDQAAKPLARPVKVGPNLMTVCLC*
• ORF Type: complete

Annotations of Ll_transcript_207716

• Blastp: Putative esterase/lipase HI_0193 from Haemophilus with 26.87% of identity
• Blastx: Protein ABHD11 from Silurana with 34.29% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (HI0193)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444614.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;