Protein coding transcript 154331

• Transcript: Ll_transcript_207718
• CDS coordinates: 330-692 (+)
• Peptide sequence: MDRSLPAPPTAVFLHGILGCRKNWGTFARRLAQGFPTWQFLLVDMRCHGDSASIKKRGPHTVQSAALDVLKLVRELRITPRVLVGHSFGGKVALSMVDQAAKPLARPVKVGPNLMTVCLC*
• ORF Type: complete

Annotations of Ll_transcript_207718

• Blastp: Putative esterase/lipase HI_0193 from Haemophilus with 34.09% of identity
• Blastx: Putative esterase/lipase HI_0193 from Haemophilus with 27.82% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (HI0193)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444614.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;